PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P05100_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 284aa    MW: 31893.1 Da    PI: 9.1699
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P05100_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox597.9e-19137191256
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            rk+ ++tkeq   Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  GSMUA_Achr8P05100_001 137 RKKLRLTKEQSAMLEDRFKEHSNLNPKQKHALAKQLNLRPRQVEVWFQNRRARTK 191
                            678899***********************************************98 PP

2HD-ZIP_I/II117.95.4e-38137226191
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            +kk+rl+keq+++LE+ F+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d e Lkr++++l+ en+rL+ke +eL+
  GSMUA_Achr8P05100_001 137 RKKLRLTKEQSAMLEDRFKEHSNLNPKQKHALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDRELLKRCCESLTVENRRLRKELQELK 224
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 eel 91 
                             +l
  GSMUA_Achr8P05100_001 225 -AL 226
                            .54 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.63E-18131194IPR009057Homeodomain-like
PROSITE profilePS5007117.086133193IPR001356Homeobox domain
SMARTSM003899.4E-16135197IPR001356Homeobox domain
PfamPF000463.0E-16137191IPR001356Homeobox domain
CDDcd000863.69E-15137194No hitNo description
Gene3DG3DSA:1.10.10.601.0E-17137191IPR009057Homeodomain-like
PROSITE patternPS000270168191IPR017970Homeobox, conserved site
SMARTSM003402.2E-21193236IPR003106Leucine zipper, homeobox-associated
PfamPF021833.6E-8193227IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MCTMSYRSFG YEWIKEKRRS QMRGGVKGKG KGKWKRKGSG EETERSMEKS REVELCDTGL  60
SLELGIGGKS TTWSTDHRSM AQRQASLTLS LSDEGCGGEA VQEAEAYKGC VEGGEEAEVE  120
LATFRGARDD DNDGSGRKKL RLTKEQSAML EDRFKEHSNL NPKQKHALAK QLNLRPRQVE  180
VWFQNRRART KLKQTEVDRE LLKRCCESLT VENRRLRKEL QELKALKFTP PLYMQLPAAT  240
LTMCPSCNRV GGSADSCNSG GAEEFAAAPP TPRFFNPFIH SATC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185193RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009412281.11e-170PREDICTED: homeobox-leucine zipper protein HOX19-like
SwissprotA2XE767e-74HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL47e-74HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLM0TMR30.0M0TMR3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P05100_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.16e-69HD-ZIP family protein